Loading ...
a specific gene mutation in the FGFR3 gene(passive) is caused byMuenke syndrome
a mutation knownto causeAlagille syndrome
trad ing a variety of lesions , including carotid dissection , cavernous sinus tumors , or pulmonary apex lesions that disrupt the long sympathetic chain(passive) may be causedHorners syndrome
genetic testing for gene mutationscauseAlagille syndrome
mutations human Jagged1 , which encodes a ligand for Notch 1(passive) is caused byAlagille syndrome
Pubmed]A nonsense mutation in MSX1causesWitkop syndrome
orderto causeKounis syndrome
mutations in human Jagged1 , which encodes a ligand for Notch1 ( 1997(passive) is caused byAlagille syndrome
a mutation in KCC3(passive) can be caused byAndermann syndrome
a mutation in or deletion of the gene(passive) is ... caused byAlagille syndrome
B.R. A nonsense mutation in MSX1causesWitkop syndrome
Ref.9"A nonsense mutation in MSX1causesWitkop syndrome
Beighton P A nonsense mutation in MSX1causesWitkop syndrome
mutations in X - linked MECP2(passive) is caused by105085143.Rett syndrome
Mutations in the JAG1 gene have been demonstratedto causeAlagille syndrome
TWIST1 gene mutations(passive) caused byChotzen syndrome
Pubmed , Xenbase Jumlongras , A nonsense mutation in MSX1causesWitkop syndrome
mutations in human Jagged 1 , which encodes a ligand for Notchl(passive) is caused byAlagille syndrome
a Pro250Arg mutation in FGFR3(passive) is caused byMuenke syndrome
Epub 2001 May 16.A nonsense mutation in MSX1causesWitkop syndrome
mutations in human jagged 1 , which encodes a ligand for Notch 1(passive) is caused byAlagille syndrome
Mingroni Netto R. Novel frameshift variant in gene SALL4causingOkihiro syndrome
mutations and large deletions in the TWIST1 gene that result in a loss of function(passive) is caused byChotzen syndrome
Taura syndrome virus ( TSV ) , which devastated populations of farmed shrimp ( Litopenaeus vannamei ) throughout the Americas(passive) caused byTaura syndrome
TWIST 1 gene mutations(passive) caused byChotzen syndrome
mutations in human Jagged1 , which en(passive) is caused byAlagille syndrome
Taura syndrome virus ( TSV ) , a small picorna - like RNA virus that has been classified in the new family Dicistroviridae(passive) is caused byTaura syndrome
Argas reflexus bite(passive) caused byKounis syndrome
Only one mutation in the FGFR3 gene has been shownto causeMuenke syndrome
a mutation in a gene located on chromosome 20(passive) is caused byAlagille syndrome
a mutation in NOTCH2 with a hepatic adenoma(passive) caused byAlagille syndrome
SALL4 mutations , Hum(passive) is caused byOkihiro syndrome
SALL4 mutations MSRRKQAKPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVASEDEATVKRLRREE(passive) is caused byOkihiro syndrome
Bepridil ... that are knownto causeDILQT syndrome
a mutation in the MSX1 gene located on chromosome 4p16(passive) is caused byWitkop syndrome
a mutation in the JAG1 or NOTCH2 gene in more than 90 % of cases(passive) is caused byAlagille syndrome
mutations in human Jagged1 , which encodes a ligand for Notch1 | Nature Genetics Linheng Li1,6 , Ian D. Krantz2 , Yu Deng3,6(passive) is caused byAlagille syndrome
an atypical resistance to thyroid hormone(passive) is caused bySECISBP2 syndrome
mutations in the human Jagged 1 gene that has been mapped to chromosome 20p12(passive) is caused byAlagille syndrome
genetic disorders(passive) is caused byAlagille syndrome
from heterogeneous gene mutations , including mutations in JAG1 on CHROMOSOME 20 ( Type 1 ) and NOTCH2 on CHROMOSOME 1 ( Type 2).Receptormay resultfrom heterogeneous gene mutations , including mutations in JAG1 on CHROMOSOME 20 ( Type 1 ) and NOTCH2 on CHROMOSOME 1 ( Type 2).Receptor
oftenresultsoften
cleft lip and palate , Hydronephrosis , Intestinal obstruction and other symptoms.[37can causecleft lip and palate , Hydronephrosis , Intestinal obstruction and other symptoms.[37
to cardiogenic shock secondary to Cobra ( naja naja ) biteleadingto cardiogenic shock secondary to Cobra ( naja naja ) bite
infertility or repeated miscarriagescan also causeinfertility or repeated miscarriages
menstrual changes and infertilitycan causemenstrual changes and infertility
serious gas because the body can not absorb food as well anymore and food gets down into the colon areacausesserious gas because the body can not absorb food as well anymore and food gets down into the colon area
liver problemsis causingliver problems
to heart problemscan eventually leadto heart problems
bile duct abnormalities in the liver , vitamin and nutrient deficiencies and affects other organscausesbile duct abnormalities in the liver , vitamin and nutrient deficiencies and affects other organs
to serious complicationscan leadto serious complications
infertility , miscarriage , or preterm delivery in future pregnanciescan causeinfertility , miscarriage , or preterm delivery in future pregnancies
a wide range of symptoms affecting numerous parts of the bodycan causea wide range of symptoms affecting numerous parts of the body
headaches , fatigue , frequent bruising , gastrointestinal bleeding , and vision abnormalities such as disease of the retina ( retinopathy).[rarediseases.org ] Headache , visual changes , and retinopathy may be the result of hyperviscosity of the blood depending on the properties of the paraprotein.[en.wikipedia.org ] Other pathophysiologic consequencesmay causeheadaches , fatigue , frequent bruising , gastrointestinal bleeding , and vision abnormalities such as disease of the retina ( retinopathy).[rarediseases.org ] Headache , visual changes , and retinopathy may be the result of hyperviscosity of the blood depending on the properties of the paraprotein.[en.wikipedia.org ] Other pathophysiologic consequences
liver damage and bile to be absorbed by the bodycausesliver damage and bile to be absorbed by the body
irritation of the sciatic nervecausesirritation of the sciatic nerve
neonatal deathscausingneonatal deaths
problems with the bile ductscausesproblems with the bile ducts
from anaphylaxis to diclofenac Tiwari AK , Tomar GS , Ganguly Sresultingfrom anaphylaxis to diclofenac Tiwari AK , Tomar GS , Ganguly S
Complications of Asherson syndrome(passive) are caused byComplications of Asherson syndrome
Complications of Muenke Syndrome(passive) are caused byComplications of Muenke Syndrome
Complications of Witkop syndrome(passive) are caused byComplications of Witkop syndrome
Complications of Faciocardiorenal syndrome(passive) are caused byComplications of Faciocardiorenal syndrome
Complications of Meige syndrome(passive) are caused byComplications of Meige syndrome
malabsorption and problems in normal growthcausesmalabsorption and problems in normal growth
when available , usually in proportion to sizeresultswhen available , usually in proportion to size
health problems in different parts of the bodycan causehealth problems in different parts of the body
to complications that affect the liver and other parts of the bodycan leadto complications that affect the liver and other parts of the body
complications that eventually make the liver ineffectivecausescomplications that eventually make the liver ineffective
in bleeding , headache , dizziness and hearing or visual problemsmay resultin bleeding , headache , dizziness and hearing or visual problems
problems in the liver , heart , eyes , spine , and kidneyscausesproblems in the liver , heart , eyes , spine , and kidneys
serious kidney problems � irritable bowel syndrome contact with someone who more likely to get complications than adultscan causeserious kidney problems � irritable bowel syndrome contact with someone who more likely to get complications than adults
problems in the liver heart eyes spine Analysis of some of the products identified in these reportscausesproblems in the liver heart eyes spine Analysis of some of the products identified in these reports
complications in other parts of the body , such as serious heart defects , such as tetralogy of Fallot , which require treatment with surgery narrowing and weakness in the blood vessels in the brain that may lead to bleeding and stroke bone problems , such as osteoporosis or frequent broken bones [ 1 ] Fawaz R , Baumann U , Ekong U , et almay causecomplications in other parts of the body , such as serious heart defects , such as tetralogy of Fallot , which require treatment with surgery narrowing and weakness in the blood vessels in the brain that may lead to bleeding and stroke bone problems , such as osteoporosis or frequent broken bones [ 1 ] Fawaz R , Baumann U , Ekong U , et al
in adequate healing time , immediate ambulation and weight - bearing , excellent ankle and knee motion , and no complicationsresultedin adequate healing time , immediate ambulation and weight - bearing , excellent ankle and knee motion , and no complications
to several complications , such as : edema , or a buildup of fluid in the legs secondary erythrocytosis , or raised levels of red blood cellscan leadto several complications , such as : edema , or a buildup of fluid in the legs secondary erythrocytosis , or raised levels of red blood cells
facial spams Limb dystonia ... usually develops in the hands ... but can also affect the arms , legs , and feet General dystoniacausesfacial spams Limb dystonia ... usually develops in the hands ... but can also affect the arms , legs , and feet General dystonia
in adverse reproductive outcomes caused by subfertility , chronic pelvic pain , menstrual disturbances , and severe pregnancy complications such as abnormal placentation including the placenta accreta spectrumresultingin adverse reproductive outcomes caused by subfertility , chronic pelvic pain , menstrual disturbances , and severe pregnancy complications such as abnormal placentation including the placenta accreta spectrum
from damage to the sympathetic chainresultingfrom damage to the sympathetic chain
have been told(passive) caused byhave been told