Loading ...
Molecular and cellular endocrinology Adipocyte - secreted factors increase osteoblast proliferation and the OPG / RANKL ratioto influenceosteoclast formation
the ability of these drugsto preventmicrocolony formation
AB - Aspirin inhibits cyclo - oxygenasethus preventingprostanoids formation
Kühn , Willenberg , Schott , Papewalis , Stumpf , Flohé , Scherbaum , Schinner : Adipocyte - secreted factors increase osteoblast proliferation and the OPG / RANKL ratioto influenceosteoclast formation
Ferritic Pearlitic Ductile Iron Using sufficient alloy additionsto preventpearlite formation
Kuhn MC , Willenberg HS , Schott M , Papewalis C , Stumpf U , Flohe S , Scherbaum WA , Schinner S. Adipocyte - secreted factors increase osteoblast proliferation and the OPG / RANKL ratioto influenceosteoclast formation
bacteria in the roots of vetch Specifically(passive) created byNodular formation
T1 - Resveratrol inhibits myeloma cell growthpreventsosteoclast formation
162670198.Resveratrol inhibits myeloma cell growthpreventsosteoclast formation
Caruso M. A dominant - negative approachpreventsdiphthamide formation
the capacity of those drugsto preventmicrocolony formation
the ability of commercial dentifricesto preventpellicle formation
Necrosis of the airway mucosa with resulting inflammationcan causepseudomembrane formation
ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQ Ameloblastin and enamelinpreventosteoclast formation
52083 Ameloblastin and enamelinpreventosteoclast formation
TGF - β1 's administration during early implantation(passive) can be prevented byosteoclast formation
N - methylated derivatives : a general strategyto preventamyloid formation
It also acts as a curlicideto preventpellicle formation
T cell adhesion to surfaces(passive) could ... be triggered byantisynapse formation
https://doi.org/10.1158/0008-5472.CAN-05-0651 Resveratrol inhibits myeloma cell growthpreventsosteoclast formation
mutations of p110α ... sufficientto triggerinvadopodia formation
part 's ability to block carcinogen - DNA binderspreventingadduct formation
all t he fluid in the circulatory space ... interstitiumcausesoedema formation
all the fluid ... a transudation of the fluid from capillaries to interstitiumcausesoedema formation
unbalanced expression of catabolic genes ... in turnpreventspellicle formation
the relationship between morphological changes and regulator mutationspreventpellicle formation
inhibits its binding to RANK receptorthereby preventingosteoclast formation
10.1158/0008 - 5472.CAN-05 - 0651 " , pages = " 9943 - -52 " , Boissy , P , Andersen , TL , Abdallah , BM , Kassem , M , Plesner , T & Delaissé , J - M 2005 , ' Resveratrol inhibits myeloma cell growthpreventsosteoclast formation
Effects of 1 gram oral or intravenous aspirin on urinary excretion of thromboxane B2 and 6-keto - PGF1α in healthy subjects — Italian Ministry of Health Effects of 1 gram oral or intravenous aspirin on urinary excretion of thromboxane B2 and 6-keto - PGF1α in healthy subjects Francesca Bucchi , Anna Bodzenta , Giovanni de Gaetano , Chiara Cerletti Aspirin inhibits cyclo - oxygenasethus preventingprostanoids formation
a transudation of the fluid free download indikator forex profit capillaries to interstitiumcausesoedema formation
that usually require a much longer incubation time and higher drug concentrationsto preventmicrotubule formation
According to Knudson ’s two - hit model for tumor suppressor genes [ 32 ] two mutations , one occurring in each of the two alleles of a gene , or one mutation in one allele of a tumor suppressor gene accompanied by the allelic loss of the remaining wild - type allele , are requiredto triggerneoplasm formation
According to Knudson 's two - hit model of tumor suppressor genes ( 5 ) , two mutations , one occurring in each of the two alleles of the gene , or one mutation in one tumor suppressor gene allele accompanied by another allelic loss of the remaining wild - type allele , are requiredto triggerneoplasm formation
some people in the study with a clear gene mutation for the the development of Alzheimer 's ... this second rare mutationpreventsamyloid formation
Resmuska & Pria ( 2007 ) verified also reduction growth on Monilinia fructicola and Sclerotium rolfsii mycelia by B. thuringiensis and F. solanipreventedsclerotia formation
metabolically medicated precipitation ... and biotically induced nucleation(passive) is influenced bycalcrete formation
The use of both antisera and fusion - minus FAST protein constructsto preventsyncytium formation
The accumulation of tumor cells around blood vesselsmay originatepseudorosette formation
Myosin 's binding to actincausescrossbridge formation
Curvature - generating proteins that we foundto influencesyncytium formation
in bone erosionresultingin bone erosion
to microcirculatory deterioration which , in turn , increases OERleadingto microcirculatory deterioration which , in turn , increases OER
in decreased bone resorption and increased bone mass in osteoporosisresultingin decreased bone resorption and increased bone mass in osteoporosis
from subsequent and successive additions of secondary dots and primary dotsresultingfrom subsequent and successive additions of secondary dots and primary dots
perpetual unilateral chromosome inheritance in mouse embryos , www.pnas.org/cgi/doi/10.1073/pnas.1517628112causesperpetual unilateral chromosome inheritance in mouse embryos , www.pnas.org/cgi/doi/10.1073/pnas.1517628112
in decreased bone resorption and decreased calcium release from boneresultingin decreased bone resorption and decreased calcium release from bone
beta cell deathcausesbeta cell death
in increased bone resorptionresultsin increased bone resorption
to enhanced bone resorptionultimately leadingto enhanced bone resorption
a cascade of events that can affect the subsequent activity of DNA binding proteins , including some transcription factors , and DNA repair pathways , resulting in perturbation of the cell cycle and eventual cell deathtriggersa cascade of events that can affect the subsequent activity of DNA binding proteins , including some transcription factors , and DNA repair pathways , resulting in perturbation of the cell cycle and eventual cell death
from cellular insensitivity to regulatory growth factors and cell signals , like neurogenin ... that would normally inhibit further proliferation of glial cells.[28may resultfrom cellular insensitivity to regulatory growth factors and cell signals , like neurogenin ... that would normally inhibit further proliferation of glial cells.[28
distortions in the DNA(passive) caused bydistortions in the DNA
to airway obstructionmay leadto airway obstruction
in crosslinking or mayresultingin crosslinking or may
a more youthful , sculpted profile Boost Collagens III & VIIcreatinga more youthful , sculpted profile Boost Collagens III & VII
to various adverse effects which are as followsleadingto various adverse effects which are as follows
Novel Avenues for Evolution | Genetics Robert J. Wright , Peggy M. Thaxton , Kamal M. El - Zik and Andrew H. Paterson Genetics August 1Has CreatedNovel Avenues for Evolution | Genetics Robert J. Wright , Peggy M. Thaxton , Kamal M. El - Zik and Andrew H. Paterson Genetics August 1
from stimulation of the host response rather than from the direct effect of bacterial productsresultedfrom stimulation of the host response rather than from the direct effect of bacterial products
unique avenues ... " Proceedings of the National Academy of Sciences , USA , vol .createdunique avenues ... " Proceedings of the National Academy of Sciences , USA , vol .
cell death due to excessive genomic damagecausedcell death due to excessive genomic damage
excessive bone resorption and low bone masscausesexcessive bone resorption and low bone mass
in less bone resorption in cortical and trabecular boneresultingin less bone resorption in cortical and trabecular bone
to severe osteoporosis - like phenotypesleadsto severe osteoporosis - like phenotypes
from vasodilation and cell permeability ( Pertusi , 2004resultingfrom vasodilation and cell permeability ( Pertusi , 2004
unique avenues for response to selection in Gossypium ( cotton ... Proceedings of the National Academy of Sciences of the United States of America , vol .createdunique avenues for response to selection in Gossypium ( cotton ... Proceedings of the National Academy of Sciences of the United States of America , vol .
about 30 diseases , also called amyloidoses , many of which are neurodegenerative , including Alzheimer , Parkinson , and Huntington diseases [ 1 ] , [ 2causesabout 30 diseases , also called amyloidoses , many of which are neurodegenerative , including Alzheimer , Parkinson , and Huntington diseases [ 1 ] , [ 2
to apoptosis mediated by the intrinsic mitochondrial pathway [ 123leadsto apoptosis mediated by the intrinsic mitochondrial pathway [ 123
novel avenues for evolution Wright , RJ ; Thaxton , PM ; El - Zik , KM ; Paterson , AH Xu , G - W ; Magill , CW ; Schertz , KF ; Hart , GE Yoder , JA ; Walsh , CP ; Bestor , TH Dispersed repetitive DNAhas creatednovel avenues for evolution Wright , RJ ; Thaxton , PM ; El - Zik , KM ; Paterson , AH Xu , G - W ; Magill , CW ; Schertz , KF ; Hart , GE Yoder , JA ; Walsh , CP ; Bestor , TH Dispersed repetitive DNA
in left - right patterning errors that often lead to congenital heartresultin left - right patterning errors that often lead to congenital heart
to either linear but often aggressive granulomatous periimplant bone lysisleadingto either linear but often aggressive granulomatous periimplant bone lysis
Novel Avenues for EvolutionThe Root Knot Nematode Resistance Gene Mi from TomatoHas CreatedNovel Avenues for EvolutionThe Root Knot Nematode Resistance Gene Mi from Tomato
to apoptosis via a pathway that involves p53S15 phosphorylation by mTOR / FRAPleadsto apoptosis via a pathway that involves p53S15 phosphorylation by mTOR / FRAP
The Morro Pelado Member of the Rio(passive) do ... is composedThe Morro Pelado Member of the Rio
Changes in hydrogen bonding(passive) caused byChanges in hydrogen bonding
unique convenuescreatedunique convenues
diffraction profile line broadening(passive) caused bydiffraction profile line broadening
a brief lattice expansion in ejecting hearts mediated by radial forcesprobably causesa brief lattice expansion in ejecting hearts mediated by radial forces
to single base substitutions , particularly G : C to Tleadsto single base substitutions , particularly G : C to T
to nitration as well throughTyr radical formationcan leadto nitration as well throughTyr radical formation
from covalent binding of NNA to wild - type and mutant opioid receptorsresultingfrom covalent binding of NNA to wild - type and mutant opioid receptors